![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 902847 | ||||||||
Common Name | ARALYDRAFT_902847 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 77aa MW: 8146.89 Da PI: 10.7983 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 136.2 | 7.9e-43 | 8 | 76 | 2 | 70 |
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ++a+veakGlnPGlivllvvggll++fl++ny+ly+yaqknlPP+kkkP+skkklkreklkqGv+vPGe 902847 8 GKAAVEAKGLNPGLIVLLVVGGLLVTFLIANYVLYMYAQKNLPPKKKKPLSKKKLKREKLKQGVPVPGE 76 5789****************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 0.004 | 12 | 76 | No hit | No description |
Pfam | PF04689 | 1.8E-38 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 77 aa Download sequence Send to blast |
MSSEGSAGKA AVEAKGLNPG LIVLLVVGGL LVTFLIANYV LYMYAQKNLP PKKKKPLSKK 60 KLKREKLKQG VPVPGE* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF372892 | 4e-88 | AF372892.1 Arabidopsis thaliana At2g37120/T2N18.12 mRNA, complete cds. | |||
GenBank | BT002669 | 4e-88 | BT002669.1 Arabidopsis thaliana At2g37120/T2N18.12 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002881490.1 | 2e-45 | hypothetical protein ARALYDRAFT_902847 | ||||
Swissprot | Q42337 | 2e-30 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | D7LJP4 | 2e-45 | D7LJP4_ARALL; Putative uncharacterized protein | ||||
STRING | scaffold_402348.1 | 5e-45 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2823 | 27 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37120.1 | 1e-13 | S1FA-like DNA-binding protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 902847 |
Entrez Gene | 9315720 |