PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 902847
Common NameARALYDRAFT_902847
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family S1Fa-like
Protein Properties Length: 77aa    MW: 8146.89 Da    PI: 10.7983
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
902847genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA136.27.9e-43876270
    S1FA  2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
            ++a+veakGlnPGlivllvvggll++fl++ny+ly+yaqknlPP+kkkP+skkklkreklkqGv+vPGe
  902847  8 GKAAVEAKGLNPGLIVLLVVGGLLVTFLIANYVLYMYAQKNLPPKKKKPLSKKKLKREKLKQGVPVPGE 76
            5789****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190130.0041276No hitNo description
PfamPF046891.8E-381276IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MSSEGSAGKA AVEAKGLNPG LIVLLVVGGL LVTFLIANYV LYMYAQKNLP PKKKKPLSKK  60
KLKREKLKQG VPVPGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3728924e-88AF372892.1 Arabidopsis thaliana At2g37120/T2N18.12 mRNA, complete cds.
GenBankBT0026694e-88BT002669.1 Arabidopsis thaliana At2g37120/T2N18.12 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881490.12e-45hypothetical protein ARALYDRAFT_902847
SwissprotQ423372e-30S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLD7LJP42e-45D7LJP4_ARALL; Putative uncharacterized protein
STRINGscaffold_402348.15e-45(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37120.11e-13S1FA-like DNA-binding protein